Pfam domain
Pfam family: TFIIS_M (PF07500.13)
Uniprot AC: P07273
RecName: Transcription elongation factor S-II
Begin-End: 146-256
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
HKLRDQVLKALYDVLAKESEHPPQSILHTAKAIESEMNKVNNCDTNEAAYKARYRIIYSN
VISKNNPDLKHKIANGDITPEFLATCDAKDLAPAPLKQKIEEIAKQNLYNA
Structures of the domain P07273 146-256
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1y1y X-ray 4 S 147-255 None
3gtm X-ray 3.8 S 147-255 None
5fmf X-ray 6 2 147-255 None
3po3 X-ray 3.3 S 147-255 None


© NPIDB team 2003 - 2019

text