Pfam domain
Pfam family: XPG_N (PF00752.19)
Uniprot AC: P07276
RecName: DNA repair protein RAD2
Begin-End: 2-93
Organism: Saccharomyces cerevisiae
Interaction Mode:  H-Bb H-Mj H-Mn 

Sequence:
GVHSFWDIAGPTARPVRLESLEDKRMAVDASIWIYQFLKAVRDQEGNAVKNSHITGFFRR
ICKLLYFGIRPVFVFDGGVPVLKRETIRQRKE
Structures of the domain P07276 2-93
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4q0z X-ray 2.4 E 2-769  H-Bb H-Mj H-Mn 
4q0z X-ray 2.4 F 2-768  H-Bb H-Mj H-Mn 
4q0w X-ray 2.1 B 2-765  H-Bb H-Mj H-Mn 


© NPIDB team 2003 - 2021

text