Pfam domain
Pfam family: Ribosomal_S19e (PF01090.18)
Uniprot AC: P07280
RecName: 40S ribosomal protein S19-A
Begin-End: 5-142
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
SVRDVAAQDFINAYASFLQRQGKLEVPGYVDIVKTSSGNEMPPQDAEGWFYKRAASVARH
IYMRKQVGVGKLNKLYGGAKSRGVRPYKHIDASGSINRKVLQALEKIGIVEISPKGGRRI
SENGQRDLDRIAAQTLEE
Structures of the domain P07280 5-142
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6fai X-ray 3.4 T 5-141 None
6eml X-ray 3.6 I 5-141 None


© NPIDB team 2003 - 2019

text