Pfam domain
Pfam family: PseudoU_synth_1 (PF01416.19)
Uniprot AC: P07649
RecName: tRNA pseudouridine synthase A
Begin-End: 151-253
Organism: Escherichia coli
Interaction Mode:   

Sequence:
AAQCLLGENDFTSFRAVQCQSRTPWRNVMHINVTRHGPYVVVDIKANAFVHHMVRNIVGS
LMEVGAHNQPESWIAELLAAKDRTLAAATAKAEGLYLVAVDYP
Structures of the domain P07649 151-253
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2nre X-ray 4 A 151-253 None
2nqp X-ray 3.5 A 151-253 None
2nqp X-ray 3.5 B 151-253 None
2nqp X-ray 3.5 D 151-253 None
2nqp X-ray 3.5 C 151-253 None
2nr0 X-ray 3.9 B 151-253 None
2nr0 X-ray 3.9 A 151-253 None
2nr0 X-ray 3.9 D 151-253 None
2nr0 X-ray 3.9 C 151-253 None


© NPIDB team 2003 - 2019

text