Pfam domain
Pfam family: RNA_pol_A_bac (PF01000.25)
Uniprot AC: P07703
RecName: DNA-directed RNA polymerases I and III subunit RPAC1
Begin-End: 83-220
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
VYFFNNTSVIQDEVLAHRIGLVPLKVDPDMLTWVDSNLPDDEKFTDENTIVLSLNVKCTR
NPDAPKGSTDPKELYNNAHVYARDLKFEPQGRQSTTFADCPVVPADPDILLAKLRPGQEI
SLKAHCILGIGGDHAKFS
Structures of the domain P07703 83-220
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6f41 X-ray 4.3 C 83-220 None
6f44 X-ray 4.2 C 83-220 None
5w65 X-ray 4.3 C 83-220 None
5w5y X-ray 3.8 C 83-220 None
6eu0 X-ray 4 C 83-220 None
5w66 X-ray 3.9 C 83-220 None
5m5x X-ray 4 C 83-220 None
5m5y X-ray 4 C 83-220 None
6f40 X-ray 3.7 C 83-220 None
6eu1 X-ray 3.4 C 83-220 None
5fj8 X-ray 3.9 C 83-220 None
5w64 X-ray 4.2 C 83-220 None
6f42 X-ray 5.5 C 83-220 None
5oa1 X-ray 4.4 C 83-220 None
5m3f X-ray 3.8 C 83-220 None


© NPIDB team 2003 - 2019

text