Pfam domain
Pfam family: tRNA-synt_1 (PF00133.21)
Uniprot AC: P07813
RecName: Leucine--tRNA ligase
Begin-End: 13-174
Organism: Escherichia coli
Interaction Mode:   

Sequence:
KVQLHWDEKRTFEVTEDESKEKYYCLSMLPYPSGRLHMGHVRNYTIGDVIARYQRMLGKN
VLQPIGWDAFGLPAEGAAVKNNTAPAPWTYDNIAYMKNQLKMLGFGYDWSRELATCTPEY
YRWEQKFFTELYKKGLVYKKTSAVNWCPNDQTVLANEQVIDG
Structures of the domain P07813 13-174
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4cqn X-ray 2.5 A 15-171 None
4cqn X-ray 2.5 D 15-171 None
4aq7 X-ray 2.5 A 15-171 None
4aq7 X-ray 2.5 D 15-171 None
3zgz X-ray 2.4 D 15-171 None
3zgz X-ray 2.4 A 15-171 None
5on2 X-ray 3.1 A 15-171 None
5on2 X-ray 3.1 D 15-171 None
5onh X-ray 3.1 A 15-171 None
5onh X-ray 3.1 D 15-171 None
5omw X-ray 2.6 A 15-171 None
5omw X-ray 2.6 D 15-171 None
5on3 X-ray 3.1 A 15-171 None
5on3 X-ray 3.1 D 15-171 None


© NPIDB team 2003 - 2019

text