Pfam domain
Pfam family: tRNA-synt_1_2 (PF13603.5)
Uniprot AC: P07813
RecName: Leucine--tRNA ligase
Begin-End: 221-404
Organism: Escherichia coli
Interaction Mode:   

Sequence:
RNWIGRSEGVEITFNVNDYDNTLTVYTTRPDTFMGCTYLAVAAGHPLAQKAAENNPELAA
FIDECRNTKVAEAEMATMEKKGVDTGFKAVHPLTGEEIPVWAANFVLMEYGTGAVMAVPG
HDQRDYEFASKYGLNIKPVILAADGSEPDLSQQALTEKGVLFNSGEFNGLDHEAAFNAIA
DKLT
Structures of the domain P07813 221-404
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4cqn X-ray 2.5 A 221-403 None
4cqn X-ray 2.5 D 221-403 None
4as1 X-ray 2.02 A 220-402 None
3zjv X-ray 2.31 A 221-403 None
4arc X-ray 2 A 221-403 None
4ari X-ray 2.08 A 221-403 None
4aq7 X-ray 2.5 A 221-403 None
4aq7 X-ray 2.5 D 221-403 None
3zgz X-ray 2.4 D 221-403 None
3zgz X-ray 2.4 A 221-403 None
3zjt X-ray 2.2 A 221-403 None
3zju X-ray 2.4 A 221-403 None
5on2 X-ray 3.1 A 221-403 None
5on2 X-ray 3.1 D 221-403 None
5onh X-ray 3.1 A 221-403 None
5onh X-ray 3.1 D 221-403 None
5omw X-ray 2.6 A 221-403 None
5omw X-ray 2.6 D 221-403 None
5on3 X-ray 3.1 A 221-403 None
5on3 X-ray 3.1 D 221-403 None


© NPIDB team 2003 - 2020

text