Pfam domain
Pfam family: RRM_1 (PF00076.21)
Uniprot AC: P07910
RecName: Heterogeneous nuclear ribonucleoproteins C1/C2
Begin-End: 18-81
Organism: Homo sapiens
Interaction Mode:   

Sequence:
VFIGNLNTLVVKKSDVEAIFSKYGKIVGCSVHKGFAFVQYVNERNARAAVAGEDGRMIAG
QVLD
Structures of the domain P07910 18-81
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2mz1 NMR A 18-80 None
2mxy NMR A 18-80 None


© NPIDB team 2003 - 2019

text