Pfam domain
Pfam family: zf-C4 (PF00105.17)
Uniprot AC: P08235
RecName: Mineralocorticoid receptor
Begin-End: 601-670
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj S-Bb S-Mj L-Bb 

Sequence:
KICLVCGDEASGCHYGVVTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRL
QKCLQAGMNL
Structures of the domain P08235 601-670
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4tnt X-ray 2.39 B 602-669  H-Bb H-Mj S-Bb S-Mj L-Bb 
4tnt X-ray 2.39 A 602-669  H-Bb H-Mj S-Bb S-Mj L-Bb 


© NPIDB team 2003 - 2019

text