Pfam domain
Pfam family: SRP-alpha_N (PF04086.12)
Uniprot AC: P08240
RecName: Signal recognition particle receptor subunit alpha
Begin-End: 27-130
Organism: Homo sapiens
Interaction Mode:   

Sequence:
GPVNALIRSVLLQERGGNNSFTHEALTLKYKLDNQFELVFVVGFQKILTLTYVDKLIDDV
HRLFRDKYRTEIQQQSALSLLNGTFDFQNDFLRLLREAEESSKI
Structures of the domain P08240 27-130
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2go5 X-ray 7.4 1 28-129 None


© NPIDB team 2003 - 2019

text