Pfam domain
Pfam family: RNA_pol_Rpb2_6 (PF00562.27)
Uniprot AC: P08518
RecName: DNA-directed RNA polymerase II subunit RPB2
Begin-End: 752-1124
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
AASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQKPLGTTRAMEY
LKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKKYGMSIT
ETFEKPQRTNTLRMKHGTYDKLDDDGLIAPGVRVSGEDVIIGKTTPISPDEEELGQRTAY
HSKRDASTPLRSTENGIVDQVLVTTNQDGLKFVKVRVRTTKIPQIGDKFASRHGQKGTIG
ITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGNEGDASPFTDIT
VEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKIHARARGPM
QVLTRQPVEGRSR
Structures of the domain P08518 752-1124
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2nvx X-ray 3.6 B 753-1124 None
3hox X-ray 3.65 B 753-1124 None
3hoy X-ray 3.4 B 753-1124 None
3hoz X-ray 3.65 B 753-1124 None
4a3j X-ray 3.7 B 753-1124 None
1y1w X-ray 4 B 753-1124 None
3s15 X-ray 3.3 B 753-1124 None
2ja6 X-ray 4 B 753-1124 None
4y7n X-ray 3.3 B 753-1124 None
3s1r X-ray 3.2 B 753-1124 None
2yu9 X-ray 3.4 B 753-1124 None
3gto X-ray 4 B 753-1124 None
6bqf X-ray 3.35 B 753-1124 None
1sfo X-ray 3.61 B 753-1124 None
1y1y X-ray 4 B 753-1124 None
2e2j X-ray 3.5 B 753-1124 None
3m4o X-ray 3.57 B 753-1124 None
3gtm X-ray 3.8 B 753-1124 None
2nvz X-ray 4.3 B 753-1124 None
1r9s X-ray 4.25 B 753-1124 None
2vum X-ray 3.4 B 753-1124 None
2r7z X-ray 3.8 B 753-1124 None
2e2i X-ray 3.41 B 753-1124 None
3gtk X-ray 3.8 B 753-1124 None
2b63 X-ray 3.8 B 753-1124 None
3po2 X-ray 3.3 B 753-1124 None
1r9t X-ray 3.5 B 753-1124 None
2ja7 X-ray 3.8 N 753-1124 None
2ja7 X-ray 3.8 B 753-1124 None
2e2h X-ray 3.95 B 753-1124 None
1y77 X-ray 4.5 B 753-1124 None
3hou X-ray 3.2 B 753-1124 None
3hou X-ray 3.2 N 753-1124 None
3hov X-ray 3.5 B 753-1124 None
3m3y X-ray 3.18 B 753-1124 None
4y52 X-ray 3.5 B 753-1124 None
6blo X-ray 3.4 B 753-1124 None
2nvt X-ray 3.36 B 753-1124 None
3i4n X-ray 3.9 B 753-1124 None
3how X-ray 3.6 B 753-1124 None
3gtq X-ray 3.8 B 753-1124 None
3s1q X-ray 3.3 B 753-1124 None
3s16 X-ray 3.24 B 753-1124 None
3i4m X-ray 3.7 B 753-1124 None
4bbs X-ray 3.6 B 753-1124 None
5c44 X-ray 3.95 B 753-1124 None
1i6h X-ray 3.3 B 753-1124 None
3gtj X-ray 3.42 B 753-1124 None
5fmf X-ray 6 B 753-1124 None
3gtp X-ray 3.9 B 753-1124 None
5c3e X-ray 3.7 B 753-1124 None
5c4x X-ray 4 B 753-1124 None
2ja8 X-ray 3.8 B 753-1124 None
2nvq X-ray 2.9 B 753-1124 None
3rzo X-ray 3 B 753-1124 None
5c4a X-ray 4.2 B 753-1124 None
5c4j X-ray 4 B 753-1124 None
3gtg X-ray 3.78 B 753-1124 None
3s2d X-ray 3.2 B 753-1124 None
3s1n X-ray 3.1 B 753-1124 None
3rzd X-ray 3.3 B 753-1124 None
4v1m X-ray 6.6 B 753-1124 None
2ja5 X-ray 3.8 B 753-1124 None
3s14 X-ray 2.85 B 753-1124 None
3s1m X-ray 3.13 B 753-1124 None
2r93 X-ray 4 B 753-1124 None
6bm2 X-ray 3.4 B 753-1124 None
4x67 X-ray 4.1 B 753-1124 None
6bm4 X-ray 2.95 B 753-1124 None
4v1o X-ray 9.7 B 753-1124 None
3s17 X-ray 3.2 B 753-1124 None
3h3v X-ray 4 C 753-1124 None
3po3 X-ray 3.3 B 753-1124 None
2r92 X-ray 3.8 B 753-1124 None
3s2h X-ray 3.3 B 753-1124 None
6blp X-ray 3.2 B 753-1124 None
5vvs X-ray 6.4 B 753-1124 None
5oqj X-ray 4.7 B 753-1124 None
3gtl X-ray 3.38 B 753-1124 None
4x6a X-ray 3.96 B 753-1124 None
5vvr X-ray 5.8 B 753-1124 None
5sva X-ray 15.3 B 753-1124 None
5fyw X-ray 4.35 B 753-1124 None


© NPIDB team 2003 - 2019

text