Pfam domain
Pfam family: RRM_1 (PF00076.21)
Uniprot AC: P08579
RecName: U2 small nuclear ribonucleoprotein B''
Begin-End: 9-80
Organism: Homo sapiens
Interaction Mode:   

Sequence:
IYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQAFVIFKELGSSTNALRQ
LQGFPFYGKPMR
Structures of the domain P08579 9-80
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1a9n X-ray 2.38 D 12-82 None
1a9n X-ray 2.38 B 12-82 None
5o9z X-ray 4.5 1 9-79 None


© NPIDB team 2003 - 2019

text