Pfam domain
Pfam family: U1snRNP70_N (PF12220.7)
Uniprot AC: P08621
RecName: U1 small nuclear ribonucleoprotein 70 kDa
Begin-End: 3-59
Organism: Homo sapiens
Interaction Mode:   

Sequence:
QFLPPNLLALFAPRDPIPYLPPLEKLPHEKHHNQPYCGIAPYIREFEDPRDAPPPTR
Structures of the domain P08621 3-59
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4pjo X-ray 3.3 n 3-58 None
4pjo X-ray 3.3 N 2-53 None
4pjo X-ray 3.3 k 3-58 None
4pjo X-ray 3.3 K 4-59 None


© NPIDB team 2003 - 2020

text