Pfam domain
Pfam family: U1snRNP70_N (PF12220.7)
Uniprot AC: P08621
RecName: U1 small nuclear ribonucleoprotein 70 kDa
Begin-End: 34-94
Organism: Homo sapiens
Interaction Mode:   

Sequence:
HNQPYCGIAPYIREFEDPRDAPPPTRAETREERMERKRREKIERRQQEVETELKMWDPHN
D
Structures of the domain P08621 34-94
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3pgw X-ray 4.4 S 36-94 None
3pgw X-ray 4.4 L 36-94 None


© NPIDB team 2003 - 2020

text