Pfam domain
Pfam family: Ribosomal_S2 (PF00318.19)
Uniprot AC: P08865
RecName: 40S ribosomal protein SA
Begin-End: 18-118
Organism: Homo sapiens
Interaction Mode:   

Sequence:
FLAAGTHLGGTNLDFQMEQYIYKRKSDGIYIINLKRTWEKLLLAARAIVAIENPADVSVI
SSRNTGQRAVLKFAAATGATPIAGRFTPGTFTNQIQAAFRE
Structures of the domain P08865 18-118
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5a2q X-ray 3.9 A 19-112 None
5flx X-ray 3.9 A 16-112 None
5oa3 X-ray 4.3 A 19-112 None


© NPIDB team 2003 - 2020

text