Pfam domain
Pfam family: PTS-HPr (PF00381.18)
Uniprot AC: P08877
RecName: Phosphocarrier protein HPr
Begin-End: 2-83
Organism: Bacillus subtilis
Interaction Mode:   

Sequence:
AQKTFKVTADSGIHARPATVLVQTASKYDADVNLEYNGKTVNLKSIMGVMSLGIAKGAEI
TISASGADENDALNALEETMKS
Structures of the domain P08877 2-83
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3oqo X-ray 2.97 D 3-82 None
3oqo X-ray 2.97 S 3-82 None
3oqm X-ray 2.96 D 3-82 None
3oqm X-ray 2.96 S 3-82 None
3oqn X-ray 3.3 D 3-82 None
3oqn X-ray 3.3 S 3-82 None


© NPIDB team 2003 - 2020

text