Pfam domain
Pfam family: N6_Mtase (PF02384.15)
Uniprot AC: P08957
RecName: Type I restriction enzyme EcoKI M protein
Begin-End: 122-450
Organism: Escherichia coli
Interaction Mode:   

Sequence:
KSRDDFGDMYEGLLQKNANETKSGAGQYFTPRPLIKTIIHLLKPQPREVVQDPAAGTAGF
LIEADRYVKSQTNDLDDLDGDTQDFQIHRAFIGLELVPGTRRLALMNCLLHDIEGNLDHG
GAIRLGNTLGSDGENLPKAHIVATNPPFGSAAGTNITRTFVHPTSNKQLCFMQHIIETLH
PGGRAAVVVPDNVLFEGGKGTDIRRDLMDKCHLHTILRLPTGIFYAQGVKTNVLFFTKGT
VANPNQDKNCTDDVWVYDLRTNMPSFGKRTPFTDEHLQPFERVYGEDPHGLSPRTEGEWS
FNAEETEVADSEENKNTDQHLATSRWRKF
Structures of the domain P08957 122-450
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2y7h X-ray 18 C 123-449 None
2y7h X-ray 18 B 123-449 None


© NPIDB team 2003 - 2020

text