Pfam domain
Pfam family: Ribosomal_L3 (PF00297.21)
Uniprot AC: P09001
RecName: 39S ribosomal protein L3, mitochondrial
Begin-End: 113-340
Organism: Homo sapiens
Interaction Mode:   

Sequence:
DGQKHVVTLLQVQDCHVLKYTSKENCNGKMATLSVGGKTVSRFRKATSILEFYRELGLPP
KQTVKIFNITDNAAIKPGTPLYAAHFRPGQYVDVTAKTIGKGFQGVMKRWGFKGQPATHG
QTKTHRRPGAVATGDIGRVWPGTKMPGKMGNIYRTEYGLKVWRINTKHNIIYVNGSVPGH
KNCLVKVKDSKLPAYKDLGKNLPFPTYFPDGDEEELPEDLYDENVCQP
Structures of the domain P09001 113-340
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5oom X-ray 3.03 E 123-340 None


© NPIDB team 2003 - 2019

text