Pfam domain
Pfam family: RRM_1 (PF00076.21)
Uniprot AC: P09012
RecName: U1 small nuclear ribonucleoprotein A
Begin-End: 12-83
Organism: Homo sapiens
Interaction Mode:   

Sequence:
IYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRS
MQGFPFYDKPMR
Structures of the domain P09012 12-83
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3k0j X-ray 3.1 A 212-282 None
3k0j X-ray 3.1 C 412-482 None
3k0j X-ray 3.1 D 512-582 None
3k0j X-ray 3.1 B 312-382 None
1drz X-ray 2.3 A 12-79 None
1m5v X-ray 2.4 F 12-82 None
1m5v X-ray 2.4 C 12-82 None
3mur X-ray 3 P 12-82 None
1aud NMR A 11-81 None
1m5k X-ray 2.4 C 12-82 None
1m5k X-ray 2.4 F 12-82 None
2oj3 X-ray 2.9 A 12-82 None
5ddp X-ray 2.3 D 11-81 None
5ddp X-ray 2.3 C 11-81 None
3pgw X-ray 4.4 A 12-82 None
3pgw X-ray 4.4 P 12-82 None
3iwn X-ray 3.2 D 907-977 None
3iwn X-ray 3.2 C 807-877 None
2nz4 X-ray 2.5 C 12-82 None
2nz4 X-ray 2.5 B 12-82 None
2nz4 X-ray 2.5 A 12-82 None
2nz4 X-ray 2.5 D 12-82 None
3muv X-ray 3.2 P 12-82 None
3ucz X-ray 2.8 P 12-82 None
1m5o X-ray 2.2 F 12-82 None
1m5o X-ray 2.2 C 12-82 None
3irw X-ray 2.7 P 12-82 None
1vbz X-ray 2.8 A 12-82 None
1u6b X-ray 3.1 A 12-82 None
1sj4 X-ray 2.7 P 12-82 None
3cun X-ray 3 B 407-474 None
3cun X-ray 3 A 307-374 None
2oih X-ray 2.4 A 12-82 None
3mxh X-ray 2.3 P 12-82 None
1vby X-ray 2.9 A 12-82 None
1urn X-ray 1.92 A 12-82 None
1urn X-ray 1.92 B 12-82 None
1urn X-ray 1.92 C 12-82 None
1vc6 X-ray 2.8 A 12-82 None
3g8t X-ray 3 A 12-82 None
3g8t X-ray 3 B 12-82 None
3g8t X-ray 3 C 12-82 None
3g8t X-ray 3 D 12-82 None
3cul X-ray 2.8 B 407-474 None
3cul X-ray 2.8 A 307-374 None
1vc0 X-ray 2.5 A 12-82 None
1vbx X-ray 2.7 A 12-82 None
3mum X-ray 2.9 P 12-82 None
3mut X-ray 3 P 12-82 None
1vc5 X-ray 3.4 A 12-82 None
1sjf X-ray 2.75 A 12-82 None
3g9c X-ray 2.9 A 12-82 None
3g9c X-ray 2.9 B 12-82 None
3g9c X-ray 2.9 C 12-82 None
3g9c X-ray 2.9 D 12-82 None
3r1h X-ray 3.15 A 12-82 None
3r1h X-ray 3.15 D 12-82 None
4w90 X-ray 3.12 B 12-79 None
1sj3 X-ray 2.2 P 12-82 None
3ud3 X-ray 3.1 P 12-82 None
3ud4 X-ray 2.7 P 12-82 None
3ucu X-ray 2.8 P 12-82 None
1dz5 NMR A 11-81 None
1dz5 NMR B 11-81 None
3bo3 X-ray 3.4 A 12-82 None
4prf X-ray 2.4 A 12-82 None
4c4w X-ray 2.95 E 12-82 None
4c4w X-ray 2.95 F 12-82 None
4c4w X-ray 2.95 B 12-82 None
4c4w X-ray 2.95 A 12-82 None
4pr6 X-ray 2.3 A 12-79 None
3egz X-ray 2.2 A 207-274 None
4yb1 X-ray 2.08 P 12-82 None
3iin X-ray 4.18 A 12-82 None
1m5p X-ray 2.6 C 12-82 None
1m5p X-ray 2.6 F 12-82 None
3bo2 X-ray 3.31 A 12-82 None
5ddq X-ray 2.4 D 11-81 None
5ddq X-ray 2.4 C 11-81 None
3r1l X-ray 3.13 A 12-82 None
3r1l X-ray 3.13 D 12-82 None
3hhn X-ray 2.99 B 12-82 None
3hhn X-ray 2.99 D 12-82 None
5fj4 X-ray 2.95 A 12-82 None
5fj4 X-ray 2.95 B 12-82 None
5fj4 X-ray 2.95 F 12-82 None
5fj4 X-ray 2.95 E 12-82 None
4w92 X-ray 3.21 B 12-79 None
5ddr X-ray 2.61 D 11-81 None
5ddr X-ray 2.61 C 11-81 None
1zzn X-ray 3.37 A 12-82 None
3l3c X-ray 2.85 A 12-82 None
3l3c X-ray 2.85 C 12-82 None
3l3c X-ray 2.85 D 12-82 None
3l3c X-ray 2.85 B 12-82 None
3g8s X-ray 3.1 A 12-82 None
3g8s X-ray 3.1 B 12-82 None
3g8s X-ray 3.1 C 12-82 None
3g8s X-ray 3.1 D 12-82 None
3bo4 X-ray 3.33 A 12-82 None
3g96 X-ray 3.01 A 12-82 None
3g96 X-ray 3.01 B 12-82 None
3g96 X-ray 3.01 C 12-82 None
3g96 X-ray 3.01 D 12-82 None
3p49 X-ray 3.55 B 12-82 None
5ddo X-ray 3.1 G 12-82 None
5ddo X-ray 3.1 C 12-82 None


© NPIDB team 2003 - 2019

text