Pfam domain
Pfam family: eIF-5_eIF-2B (PF01873.16)
Uniprot AC: P09064
RecName: Eukaryotic translation initiation factor 2 subunit beta
Begin-End: 157-265
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
KFRIPPPVCLRDGKKTIFSNIQDIAEKLHRSPEHLIQYLFAELGTSGSVDGQKRLVIKGK
FQSKQMENVLRRYILEYVTCKTCKSINTELKREQSNRLFFMVCKSCGST
Structures of the domain P09064 157-265
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3jaq X-ray 6 l 157-264 None
3jap X-ray 4.9 l 157-264 None


© NPIDB team 2003 - 2020

text