Pfam domain
Pfam family: Cdc6_C (PF09079.10)
Uniprot AC: P09119
RecName: Cell division control protein 6
Begin-End: 418-498
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
LCTIIQSLKLNSDATIDESFDHYIKAITKTDTLAPLQRNEFLEICTILETCGLVSIKKTK
CKGKTKRFVDKIDVDLDMREF
Structures of the domain P09119 418-498
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5udb X-ray 3.9 9 418-484 None
5v8f X-ray 3.9 9 418-484 None


© NPIDB team 2003 - 2019

text