Pfam domain
Pfam family: SRP19 (PF01922.16)
Uniprot AC: P09132
RecName: Signal recognition particle 19 kDa protein
Begin-End: 17-115
Organism: Homo sapiens
Interaction Mode:   

Sequence:
CIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGLNVFLEKNKMYSREWNRDV
QYRGRVRVQLKQEDGSLCLVQFPSRKSVMLYAAEMIPKL
Structures of the domain P09132 17-115
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4p3e X-ray 3.5 B 17-114 None
1jid X-ray 1.8 A 17-114 None
3ktv X-ray 3.8 D 17-114 None
3ktv X-ray 3.8 B 17-114 None
1mfq X-ray 3.1 B 17-114 None
5m73 X-ray 3.4 B 17-114 None
5m73 X-ray 3.4 F 17-114 None
1ry1 X-ray 12 B 17-114 None


© NPIDB team 2003 - 2019

text