Pfam domain
Pfam family: Vsr (PF03852.17)
Uniprot AC: P09184
RecName: Very short patch repair protein
Begin-End: 2-75
Organism: Escherichia coli
Interaction Mode:  H-Bb H-Mn S-Bb L-Bb L-Mj L-Mn 

Sequence:
ADVHDKATRSKNMRAIATRDTAIEKRLASLLTGQGLAFRVQDASLPGRPDFVVDEYRCVI
FTHGCFWHHHHCYL
Structures of the domain P09184 2-75
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1cw0 X-ray 2.3 A 2-75  H-Bb H-Mn S-Bb L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2021

text