Pfam domain
Pfam family: Vsr (PF03852.17)
Uniprot AC: P09184
RecName: Very short patch repair protein
Begin-End: 23-75
Organism: Escherichia coli
Interaction Mode:  S-Bb L-Bb L-Mj L-Mn 

Sequence:
AIEKRLASLLTGQGLAFRVQDASLPGRPDFVVDEYRCVIFTHGCFWHHHHCYL
Structures of the domain P09184 23-75
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1odg X-ray 2.8 A 23-75  S-Bb L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2021

text