Pfam domain
Pfam family: zf-U1 (PF06220.11)
Uniprot AC: P09234
RecName: U1 small nuclear ribonucleoprotein C
Begin-End: 4-38
Organism: Homo sapiens
Interaction Mode:   

Sequence:
FYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYY
Structures of the domain P09234 4-38
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4pjo X-ray 3.3 m 2-38 None
4pjo X-ray 3.3 M 2-38 None
4pjo X-ray 3.3 l 2-38 None
4pjo X-ray 3.3 L 2-38 None
3cw1 X-ray 5.49 L 4-38 None
3cw1 X-ray 5.49 9 204-238 None
3cw1 X-ray 5.49 0 404-438 None
3cw1 X-ray 5.49 l 4-38 None


© NPIDB team 2003 - 2020

text