Pfam domain
Pfam family: Ribosomal_L22 (PF00237.18)
Uniprot AC: P09594
RecName: 50S ribosomal protein L22, chloroplastic
Begin-End: 34-137
Organism: Spinacia oleracea
Interaction Mode:   

Sequence:
TRGYSISMSVDKARRVIDQIRGRSYAETLMILELMPYRACYPIFKLIYSAAANASHNKQF
NKANLIISKAEVNKGITLKKVKPRARGRSYMIKRPTCHITIVLR
Structures of the domain P09594 34-137
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5x8t X-ray 3.3 T 35-137 None
5h1s X-ray 3.5 U 35-137 None
5mlc X-ray 3.9 U 35-137 None
5mmi X-ray 3.25 T 35-137 None


© NPIDB team 2003 - 2019

text