Pfam domain
Pfam family: LRR_9 (PF14580.5)
Uniprot AC: P09661
RecName: U2 small nuclear ribonucleoprotein A'
Begin-End: 2-163
Organism: Homo sapiens
Interaction Mode:   

Sequence:
VKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFP
LLRRLKTLLVNNNRICRIGEGLDQALPCLTELILTNNSLVELGDLDPLASLKSLTYLSIL
RNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFK
Structures of the domain P09661 2-163
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1a9n X-ray 2.38 A 2-163 None
5o9z X-ray 4.5 z 2-163 None


© NPIDB team 2003 - 2019

text