Pfam domain
Pfam family: DNA_pol_lambd_f (PF10391.8)
Uniprot AC: P09838
RecName: DNA nucleotidylexotransferase
Begin-End: 250-300
Organism: Mus musculus
Interaction Mode:   

Sequence:
KLFTSVFGVGLKTAEKWFRMGFRTLSKIQSDKSLRFTQMQKAGFLYYEDLV
Structures of the domain P09838 250-300
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4iqw X-ray 2.6 A 250-299 None
4i2g X-ray 2.5 A 250-299 None
4qz8 X-ray 2.7 A 250-299 None
4qzd X-ray 2.7 A 250-299 None
4i2f X-ray 2.1 A 250-299 None
4qzi X-ray 2.65 A 250-299 None
4qza X-ray 2.15 A 250-299 None
4qzc X-ray 2.75 A 250-299 None
4i27 X-ray 2.6 A 250-299 None
4i2c X-ray 2.1 A 250-299 None
4i2h X-ray 2.75 A 250-299 None
4qzg X-ray 2.75 A 250-299 None
5d46 X-ray 2.8 A 250-299 None
5d49 X-ray 1.99 A 250-299 None
5d4b X-ray 2.66 A 250-299 None
5d4b X-ray 2.66 B 250-299 None
4iqv X-ray 2.9 A 250-299 None
4i28 X-ray 2.15 A 250-299 None
4qzf X-ray 2.6 A 250-299 None
4i2e X-ray 2 A 250-299 None
4qze X-ray 2.25 A 250-299 None
4qzb X-ray 2.15 A 250-299 None
4i2b X-ray 2.2 A 250-299 None
4i2a X-ray 1.9 A 250-299 None
4qz9 X-ray 2.05 A 250-299 None
4qzh X-ray 2.6 A 250-299 None
4i29 X-ray 2.2 A 250-299 None


© NPIDB team 2003 - 2019

text