Pfam domain
Pfam family: zf-PARP (PF00645.20)
Uniprot AC: P09874
RecName: Poly [ADP-ribose] polymerase 1
Begin-End: 12-89
Organism: Homo sapiens
Interaction Mode:  S-Bb S-Mj S-Mn L-Bb L-Mj L-Mn 

Sequence:
EYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHSIRHPDVEV
DGFSELRWDDQQKVKKTA
Structures of the domain P09874 12-89
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4dqy X-ray 3.25 A 12-89  S-Bb S-Mj S-Mn L-Bb L-Mj L-Mn 
4dqy X-ray 3.25 D 12-89  S-Bb S-Mj S-Mn L-Bb L-Mj L-Mn 
4av1 X-ray 3.1 C 12-89  S-Bb L-Bb L-Mj 
4av1 X-ray 3.1 A 12-89  S-Bb L-Bb L-Mj 
4oqb X-ray 3.36 D 12-89  S-Bb S-Mj S-Mn L-Bb L-Mj L-Mn 
4oqb X-ray 3.36 A 12-89  S-Bb S-Mj S-Mn L-Bb L-Mj L-Mn 
4opx X-ray 3.31 D 12-89  S-Bb S-Mj S-Mn L-Bb L-Mj L-Mn 
4opx X-ray 3.31 A 12-89  S-Bb S-Mj S-Mn L-Bb L-Mj L-Mn 
2n8a NMR A 12-89  S-Bb S-Mj L-Bb L-Mj L-Mn 
3od8 X-ray 2.4 G 12-89  S-Bb S-Mj S-Mn L-Bb L-Mj L-Mn 
3od8 X-ray 2.4 H 12-89  S-Bb S-Mj L-Bb L-Mj L-Mn 
3od8 X-ray 2.4 F 12-89  S-Bb S-Mj L-Bb L-Mj L-Mn 
3od8 X-ray 2.4 E 12-89  S-Bb S-Mj S-Mn L-Bb L-Mj L-Mn 
3od8 X-ray 2.4 D 12-89  S-Bb S-Mj S-Mn L-Bb L-Mj L-Mn 
3od8 X-ray 2.4 C 12-89  S-Bb S-Mj S-Mn L-Bb L-Mj L-Mn 
3od8 X-ray 2.4 B 12-89  S-Bb S-Mj L-Bb L-Mj L-Mn 
3od8 X-ray 2.4 A 12-89  S-Bb S-Mj S-Mn L-Bb L-Mj L-Mn 
3oda X-ray 2.64 G 12-89  S-Bb S-Mj S-Mn L-Bb L-Mj L-Mn 
3oda X-ray 2.64 H 12-89  S-Bb S-Mj L-Bb L-Mj L-Mn 
3oda X-ray 2.64 F 12-89  S-Bb S-Mj L-Bb L-Mj L-Mn 
3oda X-ray 2.64 E 12-89  S-Bb S-Mj L-Bb L-Mj L-Mn 
3oda X-ray 2.64 D 12-89  S-Bb S-Mj L-Bb L-Mj L-Mn 
3oda X-ray 2.64 C 12-89  S-Bb S-Mj L-Bb L-Mj L-Mn 
3oda X-ray 2.64 B 12-89  S-Bb S-Mj L-Bb L-Mj L-Mn 
3oda X-ray 2.64 A 12-89  S-Bb S-Mj L-Bb L-Mj L-Mn 
4oqa X-ray 3.65 D 12-89  S-Bb S-Mj S-Mn L-Bb L-Mj L-Mn 
4oqa X-ray 3.65 A 12-89  S-Bb S-Mj S-Mn L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2021

text