Pfam domain
Pfam family: PADR1 (PF08063.14)
Uniprot AC: P09874
RecName: Poly [ADP-ribose] polymerase 1
Begin-End: 280-331
Organism: Homo sapiens
Interaction Mode:   

Sequence:
LDRVADGMVFGALLPCEECSGQLVFKSDAYYCTGDVTAWTKCMVKTQTPNRK
Structures of the domain P09874 280-331
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4dqy X-ray 3.25 B 280-331 None
4dqy X-ray 3.25 E 280-331 None
4oqb X-ray 3.36 D 280-331 None
4oqb X-ray 3.36 A 280-331 None
4opx X-ray 3.31 D 280-331 None
4opx X-ray 3.31 A 280-331 None
4oqa X-ray 3.65 D 280-331 None
4oqa X-ray 3.65 A 280-331 None


© NPIDB team 2003 - 2021

text