Pfam domain
Pfam family: WGR (PF05406.17)
Uniprot AC: P09874
RecName: Poly [ADP-ribose] polymerase 1
Begin-End: 553-633
Organism: Homo sapiens
Interaction Mode:   

Sequence:
FSATLGLVDIVKGTNSYYKLQLLEDDKENRYWIFRSWGRVGTVIGSNKLEQMPSKEDAIE
HFMKLYEEKTGNAWHSKNFTK
Structures of the domain P09874 553-633
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4dqy X-ray 3.25 C 553-633  H-Bb S-Bb 
4dqy X-ray 3.25 F 553-633  H-Bb S-Bb 
4oqb X-ray 3.36 F 553-633  H-Bb S-Bb 
4oqb X-ray 3.36 C 553-633  H-Bb S-Bb 
4opx X-ray 3.31 F 553-633  H-Bb S-Bb 
4opx X-ray 3.31 C 553-633  H-Bb S-Bb 
4oqa X-ray 3.65 F 553-633  H-Bb S-Bb 
4oqa X-ray 3.65 C 553-633  H-Bb S-Bb 


© NPIDB team 2003 - 2021

text