Pfam domain
Pfam family: PARP (PF00644.22)
Uniprot AC: P09874
RecName: Poly [ADP-ribose] polymerase 1
Begin-End: 808-1007
Organism: Homo sapiens
Interaction Mode:   

Sequence:
SEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIEREGECQRYKPFKQLHNRRLLWHGSRTT
NFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEVALG
NMYELKHASHISKLPKGKHSVKGLGKTTPDPSANISLDGVDVPLGTGISSGVNDTSLLYN
EYIVYDIAQVNLKYLLKLKF
Structures of the domain P09874 808-1007
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4dqy X-ray 3.25 C 808-1007 None
4dqy X-ray 3.25 F 808-1007 None
4oqb X-ray 3.36 F 808-1007 None
4oqb X-ray 3.36 C 808-1007 None
4opx X-ray 3.31 F 808-1007 None
4opx X-ray 3.31 C 808-1007 None
4oqa X-ray 3.65 F 808-1007 None
4oqa X-ray 3.65 C 808-1007 None


© NPIDB team 2003 - 2021

text