Pfam domain
Pfam family: DNA_pol_B_exo1 (PF03104.18)
Uniprot AC: P09884
RecName: DNA polymerase alpha catalytic subunit
Begin-End: 369-711
Organism: Homo sapiens
Interaction Mode:  L-Bb 

Sequence:
SAETHVSCCVMVKNIERTLYFLPREMKIDLNTGKETGTPISMKDVYEEFDEKIATKYKIM
KFKSKPVEKNYAFEIPDVPEKSEYLEVKYSAEMPQLPQDLKGETFSHVFGTNTSSLELFL
MNRKIKGPCWLEVKSPQLLNQPVSWCKVEAMALKPDLVNVIKDVSPPPLVVMAFSMKTMQ
NAKNHQNEIIAMAALVHHSFALDKAAPKPPFQSHFCVVSKPKDCIFPYAFKEVIEKKNVK
VEVAATERTLLGFFLAKVHKIDPDIIVGHNIYGFELEVLLQRINVCKAPHWSKIGRLKRS
NMPKLGGRSGFGERNATCGRMICDVEISAKELIRCKSYHLSEL
Structures of the domain P09884 369-711
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5iud X-ray 3.3 A 371-710  L-Bb 
5iud X-ray 3.3 D 371-710  L-Bb 
5iud X-ray 3.3 G 371-710 None
5iud X-ray 3.3 J 371-710  L-Bb 
4q5v X-ray 2.52 A 371-710 None
4q5v X-ray 2.52 E 371-710 None


© NPIDB team 2003 - 2020

text