Pfam domain
Pfam family: DNA_pol_B (PF00136.20)
Uniprot AC: P09884
RecName: DNA polymerase alpha catalytic subunit
Begin-End: 774-1227
Organism: Homo sapiens
Interaction Mode:  H-Bb S-Bb L-Bb L-Mj L-Mn 

Sequence:
NIMSRTLMGGRSERNEFLLLHAFYENNYIVPDKQIFRKPQQKLGDEDEEIDGDTNKYKKG
RKKAAYAGGLVLDPKVGFYDKFILLLDFNSLYPSIIQEFNICFTTVQRVASEAQKVTEDG
EQEQIPELPDPSLEMGILPREIRKLVERRKQVKQLMKQQDLNPDLILQYDIRQKALKLTA
NSMYGCLGFSYSRFYAKPLAALVTYKGREILMHTKEMVQKMNLEVIYGDTDSIMINTNST
NLEEVFKLGNKVKSEVNKLYKLLEIDIDGVFKSLLLLKKKKYAALVVEPTSDGNYVTKQE
LKGLDIVRRDWCDLAKDTGNFVIGQILSDQSRDTIVENIQKRLIEIGENVLNGSVPVSQF
EINKALTKDPQDYPDKKSLPHVHVALWINSQGGRKVKAGDTVSYVICQDGSNLTASQRAY
APEQLQKQDNLTIDTQYYLAQQIHPVVARICEPI
Structures of the domain P09884 774-1227
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5iud X-ray 3.3 A 768-1227  H-Bb S-Bb L-Bb L-Mn 
5iud X-ray 3.3 D 768-1227  H-Bb S-Bb L-Bb L-Mn 
5iud X-ray 3.3 G 768-1227  H-Bb S-Bb L-Bb L-Mn 
5iud X-ray 3.3 J 768-1227  H-Bb S-Bb L-Bb L-Mn 
4q5v X-ray 2.52 A 768-1227 None
4q5v X-ray 2.52 E 768-1227 None


© NPIDB team 2003 - 2019

text