Pfam domain
Pfam family: Ribosomal_L27A (PF00828.18)
Uniprot AC: P0A0F8
RecName: 50S ribosomal protein L15
Begin-End: 27-131
Organism: Staphylococcus aureus
Interaction Mode:   

Sequence:
NGKTSGRGHKGQKARSGGGVRPGFEGGQLPLFRRLPKRGFTNINRKEYAIVNLDQLNKFE
DGTEVTPALLVESGVVKNEKSGIKILGNGSLDKKLTVKAHKFSAS
Structures of the domain P0A0F8 27-131
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5hkv X-ray 3.66 I 28-131 None
5nrg X-ray 3.44 I 28-128 None
4wce X-ray 3.53 I 28-131 None
5hl7 X-ray 3.55 I 28-131 None
4wfb X-ray 3.43 I 28-131 None
4wf9 X-ray 3.43 I 28-131 None
4wfa X-ray 3.39 I 28-131 None


© NPIDB team 2003 - 2019

text