Pfam domain
Pfam family: TetR_C_5 (PF08360.10)
Uniprot AC: P0A0N4
RecName: HTH-type transcriptional regulator QacR
Begin-End: 57-188
Organism: Staphylococcus aureus
Interaction Mode:   

Sequence:
EESKWQEQWKKEQIKCKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKM
NKLENKYIDAYHVIFKEGNLNGEWCINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMN
KFSQIFLNGLSK
Structures of the domain P0A0N4 57-188
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1jt0 X-ray 2.9 C 57-188 None
1jt0 X-ray 2.9 D 57-186 None
1jt0 X-ray 2.9 B 57-188 None
1jt0 X-ray 2.9 A 57-188 None


© NPIDB team 2003 - 2019

text