Pfam domain
Pfam family: GTP_EFTU_D2 (PF03144.24)
Uniprot AC: P0A6M8
RecName: Elongation factor G
Begin-End: 331-398
Organism: Escherichia coli
Interaction Mode:   

Sequence:
GNLTFFRVYSGVVNSGDTVLNSVKAARERFGRIVQMHANKREEIKEVRAGDIAAAIGLKD
VTTGDTLC
Structures of the domain P0A6M8 331-398
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3j0e X-ray 9.9 H 331-398 None
2rdo X-ray 9.1 7 331-398 None


© NPIDB team 2003 - 2019

text