Pfam domain
Pfam family: EFG_II (PF14492.5)
Uniprot AC: P0A6M8
RecName: Elongation factor G
Begin-End: 411-485
Organism: Escherichia coli
Interaction Mode:   

Sequence:
FPEPVISIAVEPKTKADQEKMGLALGRLAKEDPSFRVWTDEESNQTIIAGMGELHLDIIV
DRMKREFNVEANVGK
Structures of the domain P0A6M8 411-485
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3j0e X-ray 9.9 H 411-485 None
2rdo X-ray 9.1 7 411-485 None


© NPIDB team 2003 - 2019

text