Pfam domain
Pfam family: GTP_EFTU (PF00009.26)
Uniprot AC: P0A6M8
RecName: Elongation factor G
Begin-End: 8-288
Organism: Escherichia coli
Interaction Mode:   

Sequence:
ARYRNIGISAHIDAGKTTTTERILFYTGVNHKIGEVHDGAATMDWMEQEQERGITITSAA
TTAFWSGMAKQYEPHRINIIDTPGHVDFTIEVERSMRVLDGAVMVYCAVGGVQPQSETVW
RQANKYKVPRIAFVNKMDRMGANFLKVVNQIKTRLGANPVPLQLAIGAEEHFTGVVDLVK
MKAINWNDADQGVTFEYEDIPADMVELANEWHQNLIESAAEASEELMEKYLGGEELTEAE
IKGALRQRVLNNEIILVTCGSAFKNKGVQAMLDAVIDYLPS
Structures of the domain P0A6M8 8-288
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3j0e X-ray 9.9 H 9-288 None
2rdo X-ray 9.1 7 9-288 None


© NPIDB team 2003 - 2019

text