Pfam domain
Pfam family: KH_dom-like (PF14714.5)
Uniprot AC: P0A6P5
RecName: GTPase Der
Begin-End: 378-458
Organism: Escherichia coli
Interaction Mode:   

Sequence:
RVGTSMLTRIMTMAVEDHQPPLVRGRRVKLKYAHAGGYNPPIVVIHGNQVKDLPDSYKRY
LMNYFRKSLDVMGSPIRIQFK
Structures of the domain P0A6P5 378-458
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3j8g X-ray 5 X 378-458 None


© NPIDB team 2003 - 2019

text