Pfam domain
Pfam family: Bac_DNA_binding (PF00216.23)
Uniprot AC: P0A6X7
RecName: Integration host factor subunit alpha
Begin-End: 3-92
Organism: Escherichia coli
Interaction Mode:   

Sequence:
LTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPG
RNPKTGEDIPITARRVVTFRPGQKLKSRVE
Structures of the domain P0A6X7 3-92
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2iie X-ray 2.41 A 136-192 None
2iif X-ray 2.72 A 136-192 None
1ihf X-ray 2.5 A 3-92 None
1owg X-ray 2.1 A 3-92 None
2ht0 X-ray 2 A 3-92 None
1owf X-ray 1.95 A 3-92 None
1ouz X-ray 2.41 A 3-92 None
5j0n X-ray 11 K 3-92 None
5j0n X-ray 11 I 3-92 None


© NPIDB team 2003 - 2021

text