Pfam domain
Pfam family: Bac_DNA_binding (PF00216.23)
Uniprot AC: P0A6Y1
RecName: Integration host factor subunit beta
Begin-End: 1-91
Organism: Escherichia coli
Interaction Mode:   

Sequence:
MTKSELIERLATQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRT
GRNPKTGDKVELEGKYVPHFKPGKELRDRAN
Structures of the domain P0A6Y1 1-91
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2iie X-ray 2.41 A 47-136 None
2iif X-ray 2.72 A 47-136 None
1ihf X-ray 2.5 B 1-91 None
1owg X-ray 2.1 B 1-91 None
1owf X-ray 1.95 B 1-91 None
1ouz X-ray 2.41 B 1-91 None
5j0n X-ray 11 L 1-91 None
5j0n X-ray 11 J 1-91 None


© NPIDB team 2003 - 2021

text