Pfam domain
Pfam family: Ribosomal_L10 (PF00466.19)
Uniprot AC: P0A7J3
RecName: 50S ribosomal protein L10
Begin-End: 3-101
Organism: Escherichia coli
Interaction Mode:   

Sequence:
LNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLLRR
AVEGTPFECLKDAFVGPTLIAYSMEHPGAAARLFKEFAK
Structures of the domain P0A7J3 3-101
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5gag X-ray 3.8 I 331-427 None
5gae X-ray 3.33 I 5-101 None
5gah X-ray 3.8 I 331-427 None
5gad X-ray 3.7 I 7-103 None
5gaf X-ray 4.3 I 4-100 None
5ady X-ray 4.5 7 5-101 None
4uy8 X-ray 3.8 5 5-101 None
3j7z X-ray 3.9 5 5-101 None


© NPIDB team 2003 - 2019

text