Pfam domain
Pfam family: Ribosomal_L11 (PF00298.18)
Uniprot AC: P0A7J7
RecName: 50S ribosomal protein L11
Begin-End: 72-140
Organism: Escherichia coli
Interaction Mode:   

Sequence:
KTPPAAVLLKKAAGIKSGSGKPNKDKVGKISRAQLQEIAQTKAADMTGADIEAMTRSIEG
TARSMGLVV
Structures of the domain P0A7J7 72-140
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5gag X-ray 3.8 J 72-140 None
5aka X-ray 5.7 I 71-139 None
3j0d X-ray 11.1 G 71-139 None
3deg X-ray 10.9 H 71-139 None
3j8g X-ray 5 I 71-139 None
5gae X-ray 3.33 J 72-140 None
5gah X-ray 3.8 J 72-140 None
5gad X-ray 3.7 J 72-140 None
4csu X-ray 5.5 I 73-139 None
5gaf X-ray 4.3 J 72-140 None
5ady X-ray 4.5 I 71-139 None
4uy8 X-ray 3.8 I 71-139 None
3eq3 X-ray 9 I 71-139 None
2rdo X-ray 9.1 I 71-139 None
3j5l X-ray 6.6 I 71-139 None
3ep2 X-ray 9 I 71-139 None
3eq4 X-ray 12 I 71-139 None
2j28 X-ray 8 I 71-139 None
3j7z X-ray 3.9 I 71-139 None


© NPIDB team 2003 - 2019

text