Pfam domain
Pfam family: Ribosomal_L11_N (PF03946.13)
Uniprot AC: P0A7J7
RecName: 50S ribosomal protein L11
Begin-End: 8-67
Organism: Escherichia coli
Interaction Mode:   

Sequence:
YVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTDSIEKGLPIPVVITVYADRSF
Structures of the domain P0A7J7 8-67
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5gag X-ray 3.8 J 9-67 None
5gah X-ray 3.8 J 9-67 None
5gad X-ray 3.7 J 9-67 None
5gaf X-ray 4.3 J 9-67 None


© NPIDB team 2003 - 2019

text