Pfam domain
Pfam family: Ribosomal_L28 (PF00830.18)
Uniprot AC: P0A7M2
RecName: 50S ribosomal protein L28
Begin-End: 3-62
Organism: Escherichia coli
Interaction Mode:   

Sequence:
RVCQVTGKRPVTGNNRSHALNATKRRFLPNLHSHRFWVESEKRFVTLRVSAKGMRVIDKK
Structures of the domain P0A7M2 3-62
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5gag X-ray 3.8 Y 3-62 None
3j8g X-ray 5 0 2-61 None
5gae X-ray 3.33 Y 3-62 None
5gah X-ray 3.8 Y 3-62 None
5gad X-ray 3.7 Y 3-62 None
4csu X-ray 5.5 0 2-61 None
5gaf X-ray 4.3 Y 3-62 None
5ady X-ray 4.5 X 2-61 None
4uy8 X-ray 3.8 X 2-61 None
3j5l X-ray 6.6 X 2-61 None
3j7z X-ray 3.9 X 2-61 None


© NPIDB team 2003 - 2019

text