Pfam domain
Pfam family: Ribosomal_L31 (PF01197.17)
Uniprot AC: P0A7M9
RecName: 50S ribosomal protein L31
Begin-End: 1-65
Organism: Escherichia coli
Interaction Mode:   

Sequence:
MKKDIHPKYEEITASCSCGNVMKIRSTVGHDLNLDVCSKCHPFFTGKQRDVATGGRVDRF
NKRFN
Structures of the domain P0A7M9 1-65
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5aka X-ray 5.7 Z 1-65 None
2rdo X-ray 9.1 Z 1-65 None
3bbx X-ray 10 Z 1-65 None
2j28 X-ray 8 Z 1-65 None


© NPIDB team 2003 - 2019

text