Pfam domain
Pfam family: Ribosomal_S10 (PF00338.21)
Uniprot AC: P0A7R5
RecName: 30S ribosomal protein S10
Begin-End: 7-101
Organism: Escherichia coli
Interaction Mode:   

Sequence:
RIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKDARDQYE
IRTHLRLVDIVEPTEKTVDALMRLDLAAGVDVQIS
Structures of the domain P0A7R5 7-101
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5no3 X-ray 5.16 J 7-100 None
5no4 X-ray 5.16 J 7-100 None
5no2 X-ray 5.16 J 7-100 None
2ykr X-ray 9.8 J 7-100 None
5uz4 X-ray 5.8 J 7-100 None
4a2i X-ray 16.5 J 7-100 None
4adv X-ray 13.5 J 7-100 None
5my1 X-ray 7.6 J 7-100 None
5ms0 X-ray 9.8 E 7-100 None


© NPIDB team 2003 - 2019

text