Pfam domain
Pfam family: Ribosomal_S13 (PF00416.21)
Uniprot AC: P0A7S9
RecName: 30S ribosomal protein S13
Begin-End: 3-108
Organism: Escherichia coli
Interaction Mode:   

Sequence:
RIAGINIPDHKHAVIALTSIYGVGKTRSKAILAAAGIAEDVKISELSEGQIDTLRDEVAK
FVVEGDLRREISMSIKRLMDLGCYRGLRHRRGLPVRGQRTKTNART
Structures of the domain P0A7S9 3-108
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5no3 X-ray 5.16 M 3-108 None
5no4 X-ray 5.16 M 3-108 None
5no2 X-ray 5.16 M 3-108 None
2ykr X-ray 9.8 M 2-107 None
5uz4 X-ray 5.8 M 2-107 None
4a2i X-ray 16.5 M 2-107 None
4adv X-ray 13.5 M 2-107 None
5my1 X-ray 7.6 M 2-107 None


© NPIDB team 2003 - 2019

text