Pfam domain
Pfam family: Ribosomal_S16 (PF00886.18)
Uniprot AC: P0A7T3
RecName: 30S ribosomal protein S16
Begin-End: 8-68
Organism: Escherichia coli
Interaction Mode:   

Sequence:
RHGAKKRPFYQVVVADSRNARNGRFIERVGFFNPIASEKEEGTRLDLDRIAHWVGQGATI
S
Structures of the domain P0A7T3 8-68
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5no3 X-ray 5.16 P 8-68 None
5no4 X-ray 5.16 P 8-68 None
5no2 X-ray 5.16 P 8-68 None
2ykr X-ray 9.8 P 8-68 None
5uz4 X-ray 5.8 P 8-68 None
4a2i X-ray 16.5 P 8-68 None
4adv X-ray 13.5 P 8-68 None
5my1 X-ray 7.6 P 8-68 None


© NPIDB team 2003 - 2019

text